PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cucsa.250570.1
Common NameCsa_2G295940, LOC101215785
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family LBD
Protein Properties Length: 310aa    MW: 34821.8 Da    PI: 7.5517
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cucsa.250570.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260137.93.6e-4371061100
          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 
                     +CaaCk+lrrkC+++Cv+apyfp +qp+kfanvhk+FGasnv kll++l+ ++reda++sl+yeAe r+rdPvyG+vg+i+ lq++l+q++++l 
  Cucsa.250570.1   7 PCAACKFLRRKCTQECVFAPYFPPDQPQKFANVHKVFGASNVAKLLNELNATQREDAVNSLAYEAEFRLRDPVYGCVGLISVLQHKLKQMQTDLY 101
                     7********************************************************************************************99 PP

          DUF260  96 llkee 100
                      +k+e
  Cucsa.250570.1 102 NAKKE 106
                     98876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.7296107IPR004883Lateral organ boundaries, LOB
PfamPF031956.3E-437104IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009954Biological Processproximal/distal pattern formation
GO:0009965Biological Processleaf morphogenesis
GO:0048441Biological Processpetal development
Sequence ? help Back to Top
Protein Sequence    Length: 310 aa     Download sequence    Send to blast
MSSSNSPCAA CKFLRRKCTQ ECVFAPYFPP DQPQKFANVH KVFGASNVAK LLNELNATQR  60
EDAVNSLAYE AEFRLRDPVY GCVGLISVLQ HKLKQMQTDL YNAKKELASY IGPQAMLPIL  120
QPQTTPSPYN HHLSPMMGIA PSPSPSPSVP GSSQQMIIRD SAVTTPAHHH HHHLQQQQQQ  180
LFEAQQLAAA VAAREQEMFK AYEHKQSQQQ QRQQELLSFN NNNVNNQMGA SNLTLGTFVD  240
NSYQQIQQHD HQNSSSHPLQ VQLFLQPQQT QQQLEQQHHH HHQSHKPEST THADDGRINN  300
NNINIGPSC*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6819130.0LN681913.1 Cucumis melo genomic scaffold, anchoredscaffold00045.
GenBankLN7132650.0LN713265.1 Cucumis melo genomic chromosome, chr_11.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004148465.10.0PREDICTED: LOB domain-containing protein 36-like
SwissprotQ9FKZ33e-78LBD36_ARATH; LOB domain-containing protein 36
TrEMBLA0A0A0LM250.0A0A0A0LM25_CUCSA; Uncharacterized protein
STRINGPOPTR_0007s11460.11e-91(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF23533484
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66870.14e-75ASYMMETRIC LEAVES 2-like 1
Publications ? help Back to Top
  1. Ren Y, et al.
    An integrated genetic and cytogenetic map of the cucumber genome.
    PLoS ONE, 2009. 4(6): p. e5795
    [PMID:19495411]
  2. Guo S, et al.
    Transcriptome sequencing and comparative analysis of cucumber flowers with different sex types.
    BMC Genomics, 2010. 11: p. 384
    [PMID:20565788]
  3. Li Z, et al.
    RNA-Seq improves annotation of protein-coding genes in the cucumber genome.
    BMC Genomics, 2011. 12: p. 540
    [PMID:22047402]